Skip to product information
1 of 1

BDNF (Brain-derived neurotrophic factor) (10mg)

BDNF (Brain-derived neurotrophic factor) (10mg)

Regular price $150.00 USD
Regular price Sale price $150.00 USD
Sale Sold out
Shipping calculated at checkout.
Product Image

BDNF (Brain-derived neurotrophic factor) (10mg)

$150.00 USD

  • FREE SHIPPING
  • 99+% PURITY
  • MADE IN USA
View full details

All articles, product descriptions, and information provided on this website are intended solely for informational and educational purposes. The products offered are strictly for in-vitro research and laboratory use only. "In-vitro" refers to studies conducted outside of the body, such as in a controlled laboratory setting (e.g., in glassware or test tubes). These products are not intended for human or animal consumption, and any bodily introduction is strictly prohibited by law. They are not medicines, drugs, or therapeutic treatments and have not been evaluated or approved by the U.S. Food and Drug Administration (FDA) to diagnose, treat, cure, or prevent any disease or medical condition. Misuse of these products is strictly against the law and company policy. Always handle these materials responsibly and in accordance with applicable regulations.

What is BDNF (Brain-derived neurotrophic factor) (10mg)?

BDNF, a synthetic derivative of brain-derived neurotrophic factor, possesses multifunctional capabilities essential for brain health. This peptide promotes the growth, survival, and differentiation of neurons, making it a key player in neuroplasticity and cognitive enhancement. BDNF showcases its effectiveness in supporting learning and memory, improving mood, and providing neuroprotection.

Comprising a large and complex structure, BDNF's ability to bind to its receptors, TrkB and p75NTR, enables it to exert its diverse biological effects. Over extended usage periods, BDNF has been shown to significantly improve cognitive function, enhance mood, and offer neuroprotective benefits. The diverse effects of BDNF include increased synaptic plasticity, improved neural health, and reduced risk of neurodegenerative diseases. Moreover, BDNF's impact on mental health highlights its potential as a versatile agent in neurological and cognitive health management.

Chemical Structure of Reta BDNF (Brain-derived neurotrophic factor) (10mg)

BDNF, a brain-derived neurotrophic factor, is a synthetic peptide with a specific amino acid sequence. The chemical structure and sequence of BDNF are as follows:

Mature peptide sequence:

QYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRH

Structure: Contains specific disulfide bridges critical for its function.

What Are the Effects of BDNF (Brain-derived neurotrophic factor) (10mg)

Enhanced Cognitive Function
BDNF, a critical neurotrophic factor, plays a significant role in enhancing cognitive function. By promoting the growth, development, and maintenance of neurons, BDNF supports neuroplasticity, which is essential for learning and memory. This peptide's ability to enhance synaptic connections and improve brain function makes it a potent tool for cognitive health and neurological recovery.

Mood Regulation
One of the primary physiological functions of BDNF is its impact on mood regulation. BDNF enhances the survival and function of serotonergic neurons, contributing to improved mood and emotional well-being. Research indicates that higher levels of BDNF are associated with reduced symptoms of depression and anxiety, making it a valuable component in mental health management.

Neuroprotection
Beyond its cognitive and mood-enhancing effects, BDNF offers significant neuroprotective benefits. This peptide helps protect neurons from damage and supports recovery following neural injury. By promoting the survival and health of neurons, BDNF reduces the risk of neurodegenerative conditions and supports overall brain health.

Increased Synaptic Plasticity
BDNF plays a crucial role in increasing synaptic plasticity, which is the brain's ability to adapt and reorganize itself. This enhancement in synaptic plasticity contributes to improved learning, memory formation, and overall cognitive performance. BDNF's positive impact on synaptic plasticity highlights its importance in maintaining and improving brain function.

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)